Structure of PDB 8jly Chain A Binding Site BS01

Receptor Information
>8jly Chain A (length=110) Species: 9838 (Camelus dromedarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGSVQAGGSLRLSCTISDAIFSRYAVGWFRQAPGKECELVSTITPDSTTT
HSDFVKGRFTLSRDNAKNTVYLQMHSLKPDDTAVYYCASRWRSVSEGCGG
QGTQVTVSSA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jly Structural insights into the unique recognition module between alpha-synuclein peptide and nanobody.
Resolution1.29 Å
Binding residue
(original residue number in PDB)
G10 R19 L20 S21 C22 T23 I24 C95 A96 S97 R98 E104 G108 T111
Binding residue
(residue number reindexed from 1)
G2 R11 L12 S13 C14 T15 I16 C87 A88 S89 R90 E96 G100 T103
External links