Structure of PDB 8jla Chain A Binding Site BS01

Receptor Information
>8jla Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>8jla Chain I (length=156) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gctaggatcacaatcccggtgccgaggccgctcaattggtcgtagacagc
tctagcaccgcttaaacgcacgtacggaatccgtacgtgcgtttaagcgg
tgctagagctgtctacgaccaattgagcggcctcggcaccgggattgtga
tcctag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jla Contributions of histone tail clipping and acetylation in nucleosome transcription by RNA polymerase II.
Resolution3.44 Å
Binding residue
(original residue number in PDB)		H39 R42 T45 R63 R72 F84 V117 T118
Binding residue
(residue number reindexed from 1)		H2 R5 T8 R26 R35 F47 V80 T81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8jla, PDBe:8jla, PDBj:8jla
PDBsum8jla
PubMed37718728
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]