Structure of PDB 8jg4 Chain A Binding Site BS01

Receptor Information
>8jg4 Chain A (length=153) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEISVPIVYGNVAFWLGKKASEYQSHKWAVYVRGATNEDISVVVKKVVFQ
LHSSFNSPTRVIEEPPFEVSESGWGEFEIAMTLHFHSDVCDKPLSLYHHL
KLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLARVQNHPALTFPRLP
SGY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jg4 Crystal Structure of YAF9A YEATS bound to H3K27cr peptide
Resolution2.3 Å
Binding residue
(original residue number in PDB)
Y64 H93 S95 F96 G114 W115 G116 E117 F118 Y144
Binding residue
(residue number reindexed from 1)
Y23 H52 S54 F55 G73 W74 G75 E76 F77 Y103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8jg4, PDBe:8jg4, PDBj:8jg4
PDBsum8jg4
PubMed
UniProtQ9FH40|TA14B_ARATH Transcription initiation factor TFIID subunit 14b (Gene Name=TAF14B)

[Back to BioLiP]