Structure of PDB 8jfu Chain A Binding Site BS01

Receptor Information
>8jfu Chain A (length=164) Species: 53344 (Staphylococcus delphini) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMRKTIERLLNSELSSNSIAVRTGVSQAVISKLRNGKKELGNLTLNSAEK
LFEYQKEMEKVDTWIVYRGRTADMNKSYIAEGSTYEEVYNNFVDKYGYDV
LDEDIYEIQLLKKNGENLDDYDVDSDGINNYDKLDEFRESDYVDLEDYDY
RELFENSSSQVYYH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jfu AcrIIA15 in complex with palindromic DNA substrate
Resolution3.15 Å
Binding residue
(original residue number in PDB)
S14 S15 N16 Q26 A27 S30 K36
Binding residue
(residue number reindexed from 1)
S15 S16 N17 Q27 A28 S31 K37
External links