Structure of PDB 8jbx Chain A Binding Site BS01

Receptor Information

>8jbx Chain A (length=96) Species: 9606 (Homo sapiens)

PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE

Ligand information

>8jbx Chain I (length=145)

tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8jbx Human canonical 601 DNA nucleosome
• Resolution: 3.35 Å
• Binding residue (original residue number in PDB): R42 R72 F84 R116 T118
• Binding residue (residue number reindexed from 1): R5 R35 F47 R79 T81

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0045296 cadherin binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0010467 gene expression
• GO:0032200 telomere organization
• GO:0040029 epigenetic regulation of gene expression

Cellular Component

• GO:0000786 nucleosome
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:8jbx, PDBe:8jbx, PDBj:8jbx
• PDBsum: 8jbx
• UniProt: P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)