Structure of PDB 8j0r Chain A Binding Site BS01

Receptor Information

>8j0r Chain A (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGV
LRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLAR
DFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLL
AQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYL
TEALKAMDKMYLSNN

Ligand information

>8j0r Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctgcctcaggcac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8j0r Structural basis for specific DNA sequence motif recognition by the TFAP2 transcription factors.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	R254 A256 K257
Binding residue (residue number reindexed from 1)	R52 A54 K55

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8j0r, PDBe:8j0r, PDBj:8j0r
PDBsum	8j0r
PubMed	37409559
UniProt	P05549\|AP2A_HUMAN Transcription factor AP-2-alpha (Gene Name=TFAP2A)

[Back to BioLiP]