Structure of PDB 8isn Chain A Binding Site BS01

Receptor Information
>8isn Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8isn Elucidation of binding mechanism, affinity, and complex structure between mWT1 tumor-associated antigen peptide and HLA-A*24:02.
Resolution2.48 Å
Binding residue
(original residue number in PDB)
Y7 E63 K66 H70 T73 E76 N77 I80 Y84 M97 F99 H114 T143 K146 W147 Q156 Y159 T163
Binding residue
(residue number reindexed from 1)
Y7 E63 K66 H70 T73 E76 N77 I80 Y84 M97 F99 H114 T143 K146 W147 Q156 Y159 T163
Enzymatic activity
Enzyme Commision number ?
External links