Structure of PDB 8ip0 Chain A Binding Site BS01

Receptor Information
>8ip0 Chain A (length=212) Species: 1147 (Synechocystis sp. PCC 6714) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRYLRLKAPFAAFRPFQSGSFRSTTPVPSFSAVYGLLLNLAGIEQRQEVE
GKVTLIKPKAELPKLAIAIGQVKPSSTSLINQQLHNYPVGNSGKEFASRT
FGSKYWIAPVRREVLVNLDLIIGLQSPVEFWQKLDQGLKGENFLFDEIYP
IEKPDLASWYCPLEPDTRPNQGACRLTLWIDRENNTQTTIKVFSPSDFRL
EPPAKAWQQLPG
Ligand information
>8ip0 Chain F (length=44) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agagcacuuuuaucaccguguccccaaucuggauauuuugugug
............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ip0 Cryo-EM structure of type I-B Cascade bound to a PAM-containing dsDNA target at 3.6 angstrom resolution.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R25 F27 S42 G46 L47 N50 T65 Q93 Q94 L95 H96 S114 K115 Y116 I118 A119 P120 N167 F168 L169 F170 I205 R207
Binding residue
(residue number reindexed from 1)		R14 F16 S31 G35 L36 N39 T54 Q82 Q83 L84 H85 S103 K104 Y105 I107 A108 P109 N142 F143 L144 F145 I180 R182
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Biological Process
External links
PDB RCSB:8ip0, PDBe:8ip0, PDBj:8ip0
PDBsum8ip0
PubMed38750051
UniProtA0A068N1Y0

[Back to BioLiP]