Structure of PDB 8ijp Chain A Binding Site BS01

Receptor Information
>8ijp Chain A (length=159) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWFA
FLGEGQEASNGIYPVIYYYKDFDELVLAYGISDTNEPHAQWQFSSDIPKT
IAEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKLI
FNSGKSVIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ijp Structural basis of target recognition by the DNA binding domain of McrBC
Resolution1.55 Å
Binding residue
(original residue number in PDB)
S20 Q21 S22 T23 K24 Y41 G42 N43
Binding residue
(residue number reindexed from 1)
S19 Q20 S21 T22 K23 Y40 G41 N42
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:8ijp, PDBe:8ijp, PDBj:8ijp
PDBsum8ijp
PubMed
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]