Structure of PDB 8ibp Chain A Binding Site BS01

Receptor Information
>8ibp Chain A (length=143) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFERFTDRARRVVVLAQEEAKMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLS
Ligand information
>8ibp Chain C (length=16) Species: 360086 (Lentzea kentuckyensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GLRRLFADQAVGRRNI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ibp Crystal structure of the N-terminal domain of MtClpC1 in complex with the anti-mycobacterial natural peptide Lassomycin
Resolution1.45 Å
Binding residue
(original residue number in PDB)		V13 V14 Q17 H77 P79 F80 K85
Binding residue
(residue number reindexed from 1)		V13 V14 Q17 H77 P79 F80 K85
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8ibp, PDBe:8ibp, PDBj:8ibp
PDBsum8ibp
PubMed37683752
UniProtP9WPC9|CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 (Gene Name=clpC1)

[Back to BioLiP]