Structure of PDB 8ibo Chain A Binding Site BS01

Receptor Information
>8ibo Chain A (length=142) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLL
Ligand information
>8ibo Chain C (length=16) Species: 360086 (Lentzea kentuckyensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GLRRLFADQLVGRRNI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ibo Crystal structure of the N-terminal domain of MtClpC1 in complex with the anti-mycobacterial natural peptide Lassomycin
Resolution1.83 Å
Binding residue
(original residue number in PDB)		R10 V14 Q17 Y27 H77 P79 F80
Binding residue
(residue number reindexed from 1)		R10 V14 Q17 Y27 H77 P79 F80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8ibo, PDBe:8ibo, PDBj:8ibo
PDBsum8ibo
PubMed37683752
UniProtP9WPC9|CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 (Gene Name=clpC1)

[Back to BioLiP]