Structure of PDB 8ib1 Chain A Binding Site BS01

Receptor Information
>8ib1 Chain A (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMTQSPLSLPVIPGEPASISCRSSQSLLQSNGNNYLDWYLQKPGQSPQ
LLIYLGSNRASGVPDRFSGSGSGTDFTLTISRVEAEDVGVYYCLQARQSS
VLTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA
KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC
EVTHQGLSSPVTKSFNRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ib1 Structural basis for cross-group recognition of an influenza virus hemagglutinin antibody that targets postfusion stabilized epitope.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Q56 Y62 A121 R122 Q123 S124 S125
Binding residue
(residue number reindexed from 1)		Q31 Y37 A96 R97 Q98 S99 S100
External links