Structure of PDB 8ia5 Chain A Binding Site BS01

Receptor Information
>8ia5 Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH
MVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ia5 Small peptide enhances the binding of nutline-3a to N-terminal domain of MdmX
Resolution1.93 Å
Binding residue
(original residue number in PDB)		K49 M52 Y98
Binding residue
(residue number reindexed from 1)		K28 M31 Y77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ia5, PDBe:8ia5, PDBj:8ia5
PDBsum8ia5
PubMed
UniProtO15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)

[Back to BioLiP]