Structure of PDB 8i6k Chain A Binding Site BS01

Receptor Information

>8i6k Chain A (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DPVTVVVLKATAPFKYESGKSTMFHATVASKTQYFHVKVFDINLKEKFVR
KKVITISDYSECKGVMEIKEASSVSDFNQNFEVPNRIIEIANKTPKISQL
YKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDVVGSGKWHNIKCE
KGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIK

Ligand information

>8i6k Chain B (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggcgcgcgcgcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8i6k Structural mechanism of dsDNA recognition by the hMNDA HIN domain: New insights into the DNA-binding model of a PYHIN protein.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	K218 R262 R368
Binding residue (residue number reindexed from 1)	K9 R50 R156

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002218	activation of innate immune response
GO:0035458	cellular response to interferon-beta

View graph for
Biological Process

External links

PDB	RCSB:8i6k, PDBe:8i6k, PDBj:8i6k
PDBsum	8i6k
PubMed	37348588
UniProt	P41218\|MNDA_HUMAN Myeloid cell nuclear differentiation antigen (Gene Name=MNDA)

[Back to BioLiP]