Structure of PDB 8i4o Chain A Binding Site BS01

Receptor Information
>8i4o Chain A (length=208) Species: 629395 (Bacteria Latreille et al. 1825) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIFAIFTVRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHVLETQTVLSK
DPNEKRDHMVLLEFVTAAGGEELFTGVVPILVELDGDVNGHKFSVRGEGE
GDATIGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKST
MPEGYVQERTISFRDDGKYKTRAVVKFEGDTLVNRVELKGTDFKEDGNIL
GHKLEYNF
Ligand information
>8i4o Chain B (length=9) Species: 629395 (Bacteria Latreille et al. 1825) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HQKLVFFAE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i4o Engineering of a Fluorescent Protein for a Sensing of an Intrinsically Disordered Protein through Transition in the Chromophore State.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R1 I2 F3 A4 F6 V8 Q24 N39 H40 V41 L42 E43 T44 V154 Q155
Binding residue
(residue number reindexed from 1)		R1 I2 F3 A4 F6 V8 Q24 N39 H40 V41 L42 E43 T44 V131 Q132
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 18:56:17 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8i4o', asym_id = 'A', bs = 'BS01', title = 'Engineering of a Fluorescent Protein for a Sensi...ein through Transition in the Chromophore State. '
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8i4o', asym_id='A', bs='BS01', title='Engineering of a Fluorescent Protein for a Sensi...ein through Transition in the Chromophore State. ')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0006091,0008218', uniprot = '', pdbid = '8i4o', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006091,0008218', uniprot='', pdbid='8i4o', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>