Structure of PDB 8i0z Chain A Binding Site BS01

Receptor Information
>8i0z Chain A (length=340) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFV
TLTVAFRYGREDCDVLGLSFRKDLFIANYQAFPPTRPPTRLQERLLRKLG
QHAHPFFFTIPQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKSLEEKSH
KRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYY
HGEPLNVNVHVTNNSTKTVKKIKVSVRQYADIVLFSTAQYKVPVAQVEQD
DQVSPSSTFSKVYTITPFLANNREKRGLALDGKLKHEDTNLASSTIVKEG
ANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0z Structure of beta-arrestin in complex with a phosphopeptide
Resolution4.33 Å
Binding residue
(original residue number in PDB)		T7 R8 V9 F10 K11 K12 R26 K108 K295
Binding residue
(residue number reindexed from 1)		T1 R2 V3 F4 K5 K6 R20 K98 K285
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000822 inositol hexakisphosphate binding
GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
GO:0031701 angiotensin receptor binding
GO:0035091 phosphatidylinositol binding
Biological Process
GO:0002029 desensitization of G protein-coupled receptor signaling pathway
GO:0002031 G protein-coupled receptor internalization
GO:0002092 positive regulation of receptor internalization
GO:0007165 signal transduction
GO:0009968 negative regulation of signal transduction
GO:0015031 protein transport
GO:0031623 receptor internalization
GO:0070374 positive regulation of ERK1 and ERK2 cascade
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0030139 endocytic vesicle
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0z, PDBe:8i0z, PDBj:8i0z
PDBsum8i0z
PubMed37209686
UniProtP32120|ARRB2_BOVIN Beta-arrestin-2 (Gene Name=ARRB2)

[Back to BioLiP]