Structure of PDB 8huq Chain A Binding Site BS01

Receptor Information

>8huq Chain A (length=257) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DLKSLAKRIYEAYLKNFNMNKVKARVILSGPPFVIHDMETLCMAEKTLVA
KLVNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKY
GVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDF
AMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLH
LQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQ
EIYRDMY

Ligand information

>8huq Chain B (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8huq Functional and Structural Insights into the Human PPAR alpha / delta / gamma Targeting Preferences of Anti-NASH Investigational Drugs, Lanifibranor, Seladelpar, and Elafibranor.
Resolution	1.65 Å
Binding residue (original residue number in PDB)	T288 K292 L302 V306 L309 K310 L459 E462
Binding residue (residue number reindexed from 1)	T77 K81 L91 V95 L98 K99 L248 E251

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8huq, PDBe:8huq, PDBj:8huq
PDBsum	8huq
PubMed	37627519
UniProt	Q07869\|PPARA_HUMAN Peroxisome proliferator-activated receptor alpha (Gene Name=PPARA)

[Back to BioLiP]