Structure of PDB 8hpt Chain A Binding Site BS01

Receptor Information
>8hpt Chain A (length=255) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDVAALIIYSVVFLVGVPGNALVVWVTAFEAVNAIWFLNLAVADLLSCLA
LPVLFTTVLNHNYWYFDATACIVLPSLILLNMYASILLLATISADRFLLV
FKPIWCQKVRGTGLAWMACGVAWVLALLLTIPSFVYREAYKAVAILRLMV
GFVLPLLTLNICYTFLLLRTWSRKATRSTKTLKVVMAVVICFFIFWLPYQ
VTGVMIAWLPPSSPTLKRVEKLNSLCVSLAYINCCVNPIIYVMAGQGFHG
RLLRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hpt Structure of a GPCR-G protein in complex with a synthetic peptide agonist
Resolution3.39 Å
Binding residue
(original residue number in PDB)		I116 L117 Y174 R175 Y178 Y259 T262 G263 N283
Binding residue
(residue number reindexed from 1)		I78 L79 Y136 R137 Y140 Y199 T202 G203 N223
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004875 complement receptor activity
GO:0004878 complement component C5a receptor activity
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0001774 microglial cell activation
GO:0002684 positive regulation of immune system process
GO:0006935 chemotaxis
GO:0007186 G protein-coupled receptor signaling pathway
GO:0010575 positive regulation of vascular endothelial growth factor production
GO:0010759 positive regulation of macrophage chemotaxis
GO:0030593 neutrophil chemotaxis
GO:0032494 response to peptidoglycan
GO:0038178 complement component C5a signaling pathway
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045766 positive regulation of angiogenesis
GO:0048143 astrocyte activation
GO:0050679 positive regulation of epithelial cell proliferation
GO:0050830 defense response to Gram-positive bacterium
GO:0050890 cognition
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0090023 positive regulation of neutrophil chemotaxis
GO:0097242 amyloid-beta clearance
GO:0099172 presynapse organization
GO:1902947 regulation of tau-protein kinase activity
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0031410 cytoplasmic vesicle
GO:0045177 apical part of cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hpt, PDBe:8hpt, PDBj:8hpt
PDBsum8hpt
PubMed37852260
UniProtP30993|C5AR1_MOUSE C5a anaphylatoxin chemotactic receptor 1 (Gene Name=C5ar1)

[Back to BioLiP]