Structure of PDB 8hov Chain A Binding Site BS01

Receptor Information
>8hov Chain A (length=87) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHNIIEKKYRSNINDKIEQLRRTVPTLRVAYKKCNDLPITSRDLADLDGL
EPATKLNKASILTKSIEYICHLERKCLQLSLANQHLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hov Crystal structure of Hms1p from Saccharomyces cerevisiae
Resolution2.77 Å
Binding residue
(original residue number in PDB)
E7 Y10
Binding residue
(residue number reindexed from 1)
E6 Y9
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8hov, PDBe:8hov, PDBj:8hov
PDBsum8hov
PubMed
UniProtQ12398|HMS1_YEAST Probable transcription factor HMS1 (Gene Name=HMS1)

[Back to BioLiP]