Structure of PDB 8hn4 Chain A Binding Site BS01

Receptor Information
>8hn4 Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPW
IEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGC
DVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAH
VAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATL
RCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPS
GEEQRYTCHVQHEGLPKPLTLRWE
Ligand information
>8hn4 Chain E (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QYIKWPWYI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hn4 Immune escape at SARS- CoV-2 killer T cell epitope
Resolution2.853 Å
Binding residue
(original residue number in PDB)
Y31 E87 K90 H94 T97 E100 N101 I104 Y108 F123 H138 Y140 T167 W171 V176 Q180 Y183 T187 Y195
Binding residue
(residue number reindexed from 1)
Y6 E62 K65 H69 T72 E75 N76 I79 Y83 F98 H113 Y115 T142 W146 V151 Q155 Y158 T162 Y170
Enzymatic activity
Enzyme Commision number ?
External links