Structure of PDB 8hml Chain A Binding Site BS01

Receptor Information

>8hml Chain A (length=98) Species: 405948 (Saccharopolyspora erythraea NRRL 2338) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAGMLTVGDLVIEESTYTARLKGRALELTYKEFELLKYLAQHAGRVFTRA
QLLQEVWGYGGTRTVDVHVRRLRAKLGPEYDSMIGTVRNVGYKFVRPS

Ligand information

>8hml Chain D (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acgtaacatcgcggtaacac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8hml Structural insights into the transcription activation mechanism of the global regulator GlnR from actinobacteria.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	T149 Y150 W177 G184 H191 R194
Binding residue (residue number reindexed from 1)	T29 Y30 W57 G61 H68 R71

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0000160	phosphorelay signal transduction system
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8hml, PDBe:8hml, PDBj:8hml
PDBsum	8hml
PubMed	37216560
UniProt	A4FQD5

[Back to BioLiP]