Structure of PDB 8hlo Chain A Binding Site BS01

Receptor Information

>8hlo Chain A (length=67) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPGSEFVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQ
PERKGVFPVSFVHILSD

Ligand information

>8hlo Chain C (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GPGSEPPPKPPRS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8hlo Crystal Structure of the SH3 Domain of ASAP1 in Complex with the Proline Rich Motif (PRM) of MICAL1 Reveals a Unique SH3/PRM Interaction Mode.
Resolution	1.168 Å
Binding residue (original residue number in PDB)	Y1094 D1095 C1096 D1099 D1102 E1103 E1118 D1119 W1122 V1136 F1141
Binding residue (residue number reindexed from 1)	Y14 D15 C16 D19 D22 E23 E38 D39 W42 V56 F61

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005096	GTPase activator activity

	Biological Process
GO:0043547	positive regulation of GTPase activity

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8hlo, PDBe:8hlo, PDBj:8hlo
PDBsum	8hlo
PubMed	36674928
UniProt	Q9QWY8\|ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (Gene Name=Asap1)

[Back to BioLiP]