Structure of PDB 8hig Chain A Binding Site BS01

Receptor Information
>8hig Chain A (length=98) Species: 405948 (Saccharopolyspora erythraea NRRL 2338) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDGMLTVGDLVIEESTYTARLKGRALELTYKEFELLKYLAQHAGRVFTRA
QLLQEVWGYGGTRTVDVHVRRLRAKLGPEYDSMIGTVRNVGYKFVRPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hig Co-crystal structure of C-terminal DNA binding domain of Saccharopolyspora erythraea GlnR in complex with its cognate promoter DNA
Resolution2.329 Å
Binding residue
(original residue number in PDB)		T149 W177 G184 T187 H191 R194
Binding residue
(residue number reindexed from 1)		T29 W57 G61 T64 H68 R71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hig, PDBe:8hig, PDBj:8hig
PDBsum8hig
PubMed
UniProtA4FQD5

[Back to BioLiP]