Structure of PDB 8hib Chain A Binding Site BS01

Receptor Information
>8hib Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGF
LHSWWCVFWDLYCAAPERRETCEHSSEAKAFHD
Ligand information
>8hib Chain D (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YTEFAPPPTPMVDHLVASNPFEDD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hib The crystal structure of Pygo2-LDB1-SSBP2 triple complex
Resolution2.45 Å
Binding residue
(original residue number in PDB)		H32 V33 P58 Y72
Binding residue
(residue number reindexed from 1)		H22 V23 P48 Y62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding

View graph for
Molecular Function
External links
PDB RCSB:8hib, PDBe:8hib, PDBj:8hib
PDBsum8hib
PubMed
UniProtP81877|SSBP2_HUMAN Single-stranded DNA-binding protein 2 (Gene Name=SSBP2)

[Back to BioLiP]