Structure of PDB 8h2f Chain A Binding Site BS01

Receptor Information
>8h2f Chain A (length=172) Species: 1268061 (Streptococcus thermophilus DGCC 7710) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKPYVVIDIETDGLDEKKNTIIEIGAVKFNGQQVEEFNALIKYEEKLPPT
IFKLTGISKSLLDQEGRDLKEVLSEFLLFIGDLTLVGYNIHFDIQFINNK
LNKFGLPLLINKTHDIMRYVKDEKLFLDNYQLQTALKSYGIEDSVPHRAL
KDARLIYHLSTKVNKFLARMKE
Ligand information
Ligand IDTMP
InChIInChI=1S/C10H15N2O8P/c1-5-3-12(10(15)11-9(5)14)8-2-6(13)7(20-8)4-19-21(16,17)18/h3,6-8,13H,2,4H2,1H3,(H,11,14,15)(H2,16,17,18)/t6-,7+,8+/m0/s1
InChIKeyGYOZYWVXFNDGLU-XLPZGREQSA-N
SMILES
SoftwareSMILES
CACTVS 3.341CC1=CN([CH]2C[CH](O)[CH](CO[P](O)(O)=O)O2)C(=O)NC1=O
OpenEye OEToolkits 1.5.0CC1=CN(C(=O)NC1=O)C2CC(C(O2)COP(=O)(O)O)O
OpenEye OEToolkits 1.5.0CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)COP(=O)(O)O)O
CACTVS 3.341CC1=CN([C@H]2C[C@H](O)[C@@H](CO[P](O)(O)=O)O2)C(=O)NC1=O
ACDLabs 10.04O=C1NC(=O)N(C=C1C)C2OC(C(O)C2)COP(=O)(O)O
FormulaC10 H15 N2 O8 P
NameTHYMIDINE-5'-PHOSPHATE
ChEMBLCHEMBL394429
DrugBankDB01643
ZINCZINC000001678872
PDB chain8h2f Chain A Residue 401 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h2f DnaQ mediates directional spacer acquisition in the CRISPR-Cas system by a time-dependent mechanism.
Resolution1.448 Å
Binding residue
(original residue number in PDB)		E137 T138 L181 F219 H274
Binding residue
(residue number reindexed from 1)		E10 T11 L54 F92 H147
Annotation score4
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 23:01:43 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8h2f', asym_id = 'A', bs = 'BS01', title = 'DnaQ mediates directional spacer acquisition in the CRISPR-Cas system by a time-dependent mechanism.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8h2f', asym_id='A', bs='BS01', title='DnaQ mediates directional spacer acquisition in the CRISPR-Cas system by a time-dependent mechanism.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0003677,0003887,0006260', uniprot = '', pdbid = '8h2f', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0003887,0006260', uniprot='', pdbid='8h2f', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>