Structure of PDB 8h1b Chain A Binding Site BS01

Receptor Information
>8h1b Chain A (length=189) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLERILPFSKTLIKQHITPESIVVDATCGNGNDTLFLAEQVPEGHVYGF
DIQDLALENTRDKVKDFNHVSLIKDGHENIEHHINDAHKGHIDAAIFNLG
YLPKGDKSIVTKPDTTIQAINSLLSLMSIEGIIVLVIYHGHSEGQIEKHA
LLDYLSTLDQKHAQVLQYQFLNQRNHAPFICAIEKISGH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h1b Identification of a novel 5-aminomethyl-2-thiouridine methyltransferase in tRNA modification.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		K11 N33 D34 N98 G100 Y101 P103 K104 K107 Y138 G140 H141 Q173 R174 N175 A177
Binding residue
(residue number reindexed from 1)		K11 N33 D34 N98 G100 Y101 P103 K104 K107 Y138 G140 H141 Q173 R174 N175 A177
Enzymatic activity
Enzyme Commision number 2.1.1.61: tRNA 5-(aminomethyl)-2-thiouridylate-methyltransferase.
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity
Biological Process
GO:0008033 tRNA processing
GO:0032259 methylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8h1b, PDBe:8h1b, PDBj:8h1b
PDBsum8h1b
PubMed36762482
UniProtQ2FXG9|MNMM_STAA8 tRNA (mnm(5)s(2)U34)-methyltransferase (Gene Name=mnmM)

[Back to BioLiP]