Structure of PDB 8gtx Chain A Binding Site BS01

Receptor Information
>8gtx Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGF
DCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETE
DGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMP
SLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKT
Ligand information
>8gtx Chain B (length=20) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AARMCCKLDPARDVLCLRPI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gtx Crystal Structure of human Spindlin1-HBx complex
Resolution1.8 Å
Binding residue
(original residue number in PDB)		M154 K216 Q217 V218 E219 Y220 Y256 D257 L258 V259 K260 T261
Binding residue
(residue number reindexed from 1)		M110 K155 Q156 V157 E158 Y159 Y195 D196 L197 V198 K199 T200
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:8gtx, PDBe:8gtx, PDBj:8gtx
PDBsum8gtx
PubMed
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]