Structure of PDB 8gqw Chain A Binding Site BS01

Receptor Information
>8gqw Chain A (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYSYTAVSRPDRGDSRFFIVGYVDDTQFVRFDSDAPNAKMEPRAQ
WIQQEGQEYWDRETQISKETAQNYRVDLNTLRGYYNQSEAGSRTIQRVYG
CYLGPDGLLLRGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEVV
NEAEGERSYLQGRCVEWLQKYLVMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFYPKEISLSWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
>8gqw Chain C (length=9) Species: 12110 (Foot-and-mouth disease virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLRTATYY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gqw The Parallel Presentation of Two Functional CTL Epitopes Derived from the O and Asia 1 Serotypes of Foot-and-Mouth Disease Virus and Swine SLA-2*HB01: Implications for Universal Vaccine Development.
Resolution2.48 Å
Binding residue
(original residue number in PDB)		Y7 E63 I66 E69 N73 Y74 V76 D77 Y84 Y99 R114 D116 T143 K146 W147 E152 E156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 I66 E69 N73 Y74 V76 D77 Y84 Y99 R114 D116 T143 K146 W147 E152 E156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links