Structure of PDB 8gn4 Chain A Binding Site BS01

Receptor Information
>8gn4 Chain A (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKLFTRREHVKQHS
LVH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gn4 Structural insights into ZBTB10 recognition of telomeric variant repeat TTGGGG
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y729 T736 R739 H740 R748 R761 H764 Q767 H768 V771
Binding residue
(residue number reindexed from 1)		Y10 T17 R20 H21 R29 R42 H45 Q48 H49 V52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8gn4, PDBe:8gn4, PDBj:8gn4
PDBsum8gn4
PubMed36657642
UniProtQ96DT7|ZBT10_HUMAN Zinc finger and BTB domain-containing protein 10 (Gene Name=ZBTB10)

[Back to BioLiP]