Structure of PDB 8gn3 Chain A Binding Site BS01

Receptor Information
>8gn3 Chain A (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLIMNKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKLFTRREHV
KRHSLVH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gn3 Structural insights into ZBTB10 recognition of telomeric variant repeat TTGGGG
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y729 Y733 R739 H740 I743 R748 R761 H764 R767 H768
Binding residue
(residue number reindexed from 1)		Y14 Y18 R24 H25 I28 R33 R46 H49 R52 H53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8gn3, PDBe:8gn3, PDBj:8gn3
PDBsum8gn3
PubMed36657642
UniProtQ96DT7|ZBT10_HUMAN Zinc finger and BTB domain-containing protein 10 (Gene Name=ZBTB10)

[Back to BioLiP]