Structure of PDB 8gme Chain A Binding Site BS01

Receptor Information
>8gme Chain A (length=267) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKN
DEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTD
NKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIA
VDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDD
ESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAA
KKADKVADDLDAFNVDD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gme Crystal structure of the gp32-Dda-dT17 complex
Resolution4.98 Å
Binding residue
(original residue number in PDB)		G22 F23 K67 N69 G70 K71 I74 R138
Binding residue
(residue number reindexed from 1)		G20 F21 K65 N67 G68 K69 I72 R136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0039686 bidirectional double-stranded viral DNA replication
GO:0039693 viral DNA genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8gme, PDBe:8gme, PDBj:8gme
PDBsum8gme
PubMed
UniProtP03695|SSB_BPT4 Single-stranded DNA-binding protein (Gene Name=32)

[Back to BioLiP]