Structure of PDB 8gji Chain A Binding Site BS01

Receptor Information
>8gji Chain A (length=167) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMEKLAEIMQEIIEAYQEVKDAFFKFIKAVHEGAPEEELKKYLEKMKEA
LEKMKELLERLEKEAKKVIEENKDKKLELKVLLMLRLAYLLLKVSIELTK
IAAEKLGDKELVEELEKESKEVEKKIKELEERIKKLLEEVDDEELKEAYK
EVEEMEKEAEKFLEKMR
Ligand information
>8gji Chain B (length=22) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SDYSKYLDSRRAQDFVQWLMNT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gji De novo design of high-affinity binders of bioactive helical peptides.
Resolution1.81 Å
Binding residue
(original residue number in PDB)		M5 I16 Y19 Q20 K23 K78 K82 L85 M86 L89 E146 L147 A150 E153 V154 E156 M157 E160 A161 F164 K167
Binding residue
(residue number reindexed from 1)		M3 I14 Y17 Q18 K21 K76 K80 L83 M84 L87 E144 L145 A148 E151 V152 E154 M155 E158 A159 F162 K165
External links