Structure of PDB 8gj5 Chain A Binding Site BS01

Receptor Information

>8gj5 Chain A (length=253) Species: 746128 (Aspergillus fumigatus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLEARLEQASLLKRVVDAIKDLVQDCNFDCNDSGIALQAMDNSHVALVSM
LLKAEGFSPYRCDRNIALGINLVSLTKVLRAAQNEDILTLKADDSPDAVN
LMFESAETDRISEYDIKLMDIDQEHLAIPETEYAATVEMPSAEFQRICRD
LNALSESVVIEATKEGVKFSCQGDIGSGSVTIRQHTSVDKPEQNVSIALS
EPVALTFSLKYLVNFCKATSLSSKVTLCLSQEVPLLVEYGLGSGHLRFYL
APK

Ligand information

>8gj5 Chain D (length=9) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TDIRNFFHS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8gj5 Towards a High-Affinity Peptidomimetic Targeting Proliferating Cell Nuclear Antigen from Aspergillus fumigatus.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	M40 H44 V45 L126 A127 P129 E232 P234 A251
Binding residue (residue number reindexed from 1)	M40 H44 V45 L126 A127 P129 E232 P234 A251

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0030337	DNA polymerase processivity factor activity

	Biological Process
GO:0006275	regulation of DNA replication

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8gj5, PDBe:8gj5, PDBj:8gj5
PDBsum	8gj5
PubMed	37998903
UniProt	A0A229Y5V5

[Back to BioLiP]