Structure of PDB 8gho Chain A Binding Site BS01

Receptor Information
>8gho Chain A (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWIGE
IKPSNELTNVHEKFKDRFTISVDKAKNSAYLQMNSLRAEDTAVYYCTRTI
TTTEGYWFFDVWGQGTLVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gho Molecular insights into recognition of GUCY2C by T-cell engaging bispecific antibody anti-GUCY2CxCD3.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
W33 E50 L57 T58 N59 E104 G105 W107
Binding residue
(residue number reindexed from 1)
W33 E50 L57 T58 N59 E104 G105 W107
External links