Structure of PDB 8gh7 Chain A Binding Site BS01

Receptor Information
>8gh7 Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFH
CGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gh7 Characterization of a Potent and Orally Bioavailable Lys-Covalent Inhibitor of Apoptosis Protein (IAP) Antagonist.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
G306 L307 T308 D309 W310 E314 Q319 W323 Y324
Binding residue
(residue number reindexed from 1)
G54 L55 T56 D57 W58 E62 Q67 W71 Y72
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:8gh7, PDBe:8gh7, PDBj:8gh7
PDBsum8gh7
PubMed37262387
UniProtP98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP)

[Back to BioLiP]