Structure of PDB 8gcr Chain A Binding Site BS01

Receptor Information
>8gcr Chain A (length=140) Species: 83333,333760 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDL
CIVYRDGNPYAVCDKCLKFYSKISEYRHYSYSLYGTTLEQQYNKPLSDLL
IRCINCQKPLSPEEKQRHLDKKQRFHNIRGRWTGRCMSCS
Ligand information
Ligand IDZN
InChIInChI=1S/Zn/q+2
InChIKeyPTFCDOFLOPIGGS-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Zn++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Zn+2]
FormulaZn
NameZINC ION
ChEMBLCHEMBL1236970
DrugBankDB14532
ZINC
PDB chain8gcr Chain A Residue 500 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gcr Structure of the p53 degradation complex from HPV16.
Resolution3.38 Å
Binding residue
(original residue number in PDB)		C37 C40 C73
Binding residue
(residue number reindexed from 1)		C30 C33 C66
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:0030165 PDZ domain binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:1901982 maltose binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006974 DNA damage response
GO:0008643 carbohydrate transport
GO:0015768 maltose transport
GO:0019049 virus-mediated perturbation of host defense response
GO:0030162 regulation of proteolysis
GO:0034219 carbohydrate transmembrane transport
GO:0034289 detection of maltose stimulus
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039548 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity
GO:0039648 symbiont-mediated perturbation of host ubiquitin-like protein modification
GO:0039653 symbiont-mediated suppression of host transcription
GO:0042956 maltodextrin transmembrane transport
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0052150 symbiont-mediated perturbation of host apoptosis
GO:0055085 transmembrane transport
GO:0060326 cell chemotaxis
GO:0090630 activation of GTPase activity
Cellular Component
GO:0016020 membrane
GO:0030288 outer membrane-bounded periplasmic space
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0042597 periplasmic space
GO:0043190 ATP-binding cassette (ABC) transporter complex
GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060 maltose transport complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gcr, PDBe:8gcr, PDBj:8gcr
PDBsum8gcr
PubMed38418456
UniProtP03126|VE6_HPV16 Protein E6 (Gene Name=E6);
P0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE)

[Back to BioLiP]