Structure of PDB 8g9t Chain A Binding Site BS01

Receptor Information
>8g9t Chain A (length=70) Species: 754047 (Rhodobacter phage RcNL1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTSFYKITAYNSQALYFWGTDADVDRYVDWLNRDREINVYAAEAIPEAEW
AQYEGRDDVLSGEECGWDDF
Ligand information
>8g9t Chain O (length=43) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaacagggucagcuugccguagguggcaucgcccucguaaaa
...........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g9t Exploiting activation and inactivation mechanisms in type I-C CRISPR-Cas3 for genome-editing applications.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Y125 N126 I152 N153
Binding residue
(residue number reindexed from 1)		Y10 N11 I37 N38
Enzymatic activity
Enzyme Commision number ?
External links