Structure of PDB 8g8a Chain A Binding Site BS01

Receptor Information
>8g8a Chain A (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGSELKKPGASVKVSCEASGYTFTDYAITWVRQAPGQGLEWMAW
INTNTGNPTSAQGFTGRFVFSLGTSVNTTYLQIRSLRAEDTAVYYCARLR
RGGYNNYYMDVWGTGSMVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKVEPK
Ligand information
>8g8a Chain C (length=14) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KNEQELLELDKWAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g8a Vaccine induction of heterologous HIV-1 neutralizing antibody B cell lineages in humans
Resolution2.44 Å
Binding residue
(original residue number in PDB)		Y32 A33 W50 T52A N53 R96 R97 Y100 Y100C
Binding residue
(residue number reindexed from 1)		Y32 A33 W50 T53 N54 R100 R101 Y104 Y107
External links