Structure of PDB 8g7t Chain A Binding Site BS01

Receptor Information
>8g7t Chain A (length=647) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQK
GKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVEN
NDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNY
LDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIA
TVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRIC
KDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL
YTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRF
EEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALV
DALKNWIEGNPKLSFLKPGILTDHNILIATSVIAQCNLVILYEYVIKMIQ
TRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVF
REKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVI
EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH
VKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEM
Ligand information
>8g7t Chain X (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacguacguuucgcgacuguaga
........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g7t Cryo-EM structure of Riplet:RIG-I:dsRNA complex (end-inter)
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K379 Q380 Q500 Q507 K508 Q511 K750 C829 H847 F853 K888
Binding residue
(residue number reindexed from 1)		K139 Q140 Q260 Q267 K268 Q271 K474 C553 H571 F577 K612
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0003725 double-stranded RNA binding
GO:0003727 single-stranded RNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005525 GTP binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0031625 ubiquitin protein ligase binding
GO:0038187 pattern recognition receptor activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0002230 positive regulation of defense response to virus by host
GO:0002376 immune system process
GO:0002735 positive regulation of myeloid dendritic cell cytokine production
GO:0002753 cytoplasmic pattern recognition receptor signaling pathway
GO:0009597 detection of virus
GO:0009615 response to virus
GO:0010467 gene expression
GO:0010628 positive regulation of gene expression
GO:0030334 regulation of cell migration
GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0032727 positive regulation of interferon-alpha production
GO:0032728 positive regulation of interferon-beta production
GO:0032755 positive regulation of interleukin-6 production
GO:0032757 positive regulation of interleukin-8 production
GO:0032760 positive regulation of tumor necrosis factor production
GO:0034344 regulation of type III interferon production
GO:0039529 RIG-I signaling pathway
GO:0043330 response to exogenous dsRNA
GO:0045087 innate immune response
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051607 defense response to virus
GO:0060760 positive regulation of response to cytokine stimulus
GO:0071360 cellular response to exogenous dsRNA
GO:0140374 antiviral innate immune response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005923 bicellular tight junction
GO:0015629 actin cytoskeleton
GO:0032587 ruffle membrane
GO:0042995 cell projection
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g7t, PDBe:8g7t, PDBj:8g7t
PDBsum8g7t
PubMed37951994
UniProtO95786|RIGI_HUMAN Antiviral innate immune response receptor RIG-I (Gene Name=RIGI)

[Back to BioLiP]