Structure of PDB 8g0l Chain A Binding Site BS01

Receptor Information
>8g0l Chain A (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGG
ELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISE
RKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYD
MRKALSRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g0l Semi-synthetic CoA-alpha-Synuclein Constructs Trap N-terminal Acetyltransferase NatB for Binding Mechanism Studies.
Resolution3.39 Å
Binding residue
(original residue number in PDB)		T24 E25 Y27 T75 F111 Y137
Binding residue
(residue number reindexed from 1)		T23 E24 Y26 T74 F110 Y136
Enzymatic activity
Enzyme Commision number 2.3.1.254: N-terminal methionine N(alpha)-acetyltransferase NatB.
Gene Ontology
Molecular Function
GO:0004596 peptide alpha-N-acetyltransferase activity
GO:0005515 protein binding
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
Biological Process
GO:0006474 N-terminal protein amino acid acetylation
GO:0017190 N-terminal peptidyl-aspartic acid acetylation
GO:0017192 N-terminal peptidyl-glutamine acetylation
GO:0018002 N-terminal peptidyl-glutamic acid acetylation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031416 NatB complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g0l, PDBe:8g0l, PDBj:8g0l
PDBsum8g0l
PubMed37066334
UniProtP61599|NAA20_HUMAN N-alpha-acetyltransferase 20 (Gene Name=NAA20)

[Back to BioLiP]