Structure of PDB 8fy5 Chain A Binding Site BS01

Receptor Information
>8fy5 Chain A (length=387) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIA
VYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSL
MVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRA
LYRRHVLGIVLDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPK
DVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATR
AMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELERVRVSCTIIFLASIF
QLAMWTTALLHQAETLQPSVWFGGREHVLMFAKLALYPCASLLAFASTCL
LSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVL
Ligand information
>8fy5 Chain C (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LIPIAVGGALAGLVLIVLIAYLVGRKRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fy5 Lysosomal LAMP proteins regulate lysosomal pH by direct inhibition of the TMEM175 channel.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		F384 L391 L399 F411 H416 F420 F434
Binding residue
(residue number reindexed from 1)		F295 L302 L310 F322 H327 F331 F345
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005267 potassium channel activity
GO:0005515 protein binding
GO:0015252 proton channel activity
GO:0022841 potassium ion leak channel activity
GO:0050544 arachidonate binding
Biological Process
GO:0035751 regulation of lysosomal lumen pH
GO:0035752 lysosomal lumen pH elevation
GO:0070050 neuron cellular homeostasis
GO:0071805 potassium ion transmembrane transport
GO:0090385 phagosome-lysosome fusion
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0010008 endosome membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fy5, PDBe:8fy5, PDBj:8fy5
PDBsum8fy5
PubMed37390818
UniProtQ9BSA9|TM175_HUMAN Endosomal/lysosomal proton channel TMEM175 (Gene Name=TMEM175)

[Back to BioLiP]