Structure of PDB 8fvi Chain A Binding Site BS01

Receptor Information
>8fvi Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKK
CHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIQAHDHL
NLRIFASRLYYHWCKPQQDGLRLLCGSQVPVEVMGFPEFADCWENFVDHE
KPLSFNPYKMLEELDKNSRAIKRRLDRIKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fvi Structural basis of HIV-1 Vif-mediated E3 ligase targeting of host APOBEC3H
Resolution3.24 Å
Binding residue
(original residue number in PDB)
R17 Y23 Y24 P25 R26 W82 L111 Y113 W115
Binding residue
(residue number reindexed from 1)
R15 Y21 Y22 P23 R24 W80 L109 Y111 W113
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003824 catalytic activity
GO:0004126 cytidine deaminase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0010526 retrotransposon silencing
GO:0016554 cytidine to uridine editing
GO:0044355 clearance of foreign intracellular DNA
GO:0044828 negative regulation by host of viral genome replication
GO:0045087 innate immune response
GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
GO:0051607 defense response to virus
GO:0070383 DNA cytosine deamination
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fvi, PDBe:8fvi, PDBj:8fvi
PDBsum8fvi
PubMed37640699
UniProtQ6NTF7|ABC3H_HUMAN DNA dC->dU-editing enzyme APOBEC-3H (Gene Name=APOBEC3H)

[Back to BioLiP]