Structure of PDB 8fmz Chain A Binding Site BS01

Receptor Information

>8fmz Chain A (length=280) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLASTVHYHLGSLA
LSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNV
ASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGL
QNRSAGTHPGGLVCTPIVDTATVKVVIQVNTFMSFLFPMLVISILNTVIA
NKLTVMLRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDF
YHYFYMLTNALFYASSAINPILYNLVSANF

Ligand information

>8fmz Chain F (length=6) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RRPYIL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8fmz Neurotensin Receptor Allosterism Revealed in Complex with a Biased Allosteric Modulator.
Resolution	2.59 Å
Binding residue (original residue number in PDB)	L55 F128 R327 R328 F331 W339 F344 Y347
Binding residue (residue number reindexed from 1)	L4 F68 R231 R232 F235 W243 F248 Y251

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0016492	G protein-coupled neurotensin receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fmz, PDBe:8fmz, PDBj:8fmz
PDBsum	8fmz
PubMed	36917754
UniProt	P20789\|NTR1_RAT Neurotensin receptor type 1 (Gene Name=Ntsr1)

[Back to BioLiP]