Structure of PDB 8fdc Chain A Binding Site BS01

Receptor Information
>8fdc Chain A (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QMHLVESGGGVVQPGRSLRLSCVASGFTFNNHGMHWVRQAPGKGLEWVAV
IWHDGSNKFYADSVNGRFIVSRDNSKNTLYLHMNSLRAEDTAVYYCARDF
FVSGSYNYFDPWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEP
Ligand information
>8fdc Chain P (length=9) Species: 5843 (Plasmodium falciparum NF54) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DGNPDPNAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fdc Molecular determinants of cross-reactivity and potency by VH3-33 antibodies against the Plasmodium falciparum circumsporozoite protein
Resolution1.8 Å
Binding residue
(original residue number in PDB)		N31 H32 G33 W52 H52A D95 F97 Y100B N100C
Binding residue
(residue number reindexed from 1)		N31 H32 G33 W52 H53 D99 F101 Y106 N107
External links