Structure of PDB 8fax Chain A Binding Site BS01

Receptor Information
>8fax Chain A (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGASMKVSCKASGFTFTDYYMHWVRQAPRQGLEWMGL
INPSGSGTAYAQNFQGRVTLARDTSTSTLYMEMGSLTSDDTAVYYCARMD
SSGSYDHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPKSC
Ligand information
>8fax Chain L (length=12) Species: 1335626 (Middle East respiratory syndrome-related coronavirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DFQDELDEFFKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fax Structure and epitope of a neutralizing monoclonal antibody that targets the stem helix of beta coronaviruses.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y33 L50 G57 T58 M99 S101 S102 G103
Binding residue
(residue number reindexed from 1)		Y33 L50 G57 T58 M99 S101 S102 G103
External links