Structure of PDB 8f9v Chain A Binding Site BS01

Receptor Information
>8f9v Chain A (length=225) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGNVVQPGRSLRLSCTASGFTFSSYGMHWVRQAPDKGLEWVAI
IWYDGGNKFYADSVKGRFTISRDNSKDTLYLQMNSLRAEDTAVYYCAKAW
YKIDDKYSMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>8f9v Chain M (length=8) Species: 5843 (Plasmodium falciparum NF54) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PDPNANPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f9v Molecular determinants of cross-reactivity and potency by VH3-33 antibodies against the Plasmodium falciparum circumsporozoite protein
Resolution2.25 Å
Binding residue
(original residue number in PDB)		S31 Y32 G33 W52 Y52A F58 K100B Y100C
Binding residue
(residue number reindexed from 1)		S31 Y32 G33 W52 Y53 F59 K106 Y107
External links