Structure of PDB 8f86 Chain A Binding Site BS01

Receptor Information
>8f86 Chain A (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKQTARKSTGGHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD
FKTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLA
RRIRGER
Ligand information
>8f86 Chain I (length=148) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcacaggatgtatatatctgacacgtgcctggagactagggagtaatccc
cttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgc
tagagctgtctacgaccaattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f86 Structural Basis of Sirtuin 6-Catalyzed Nucleosome Deacetylation.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T3 R40 V46 A47 R63 K64 L65 P66
Binding residue
(residue number reindexed from 1)		T1 R13 V19 A20 R36 K37 L38 P39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8f86, PDBe:8f86, PDBj:8f86
PDBsum8f86
PubMed36930461
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]