Structure of PDB 8f7m Chain A Binding Site BS01

Receptor Information
>8f7m Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAP
WIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYG
CDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f7m Crystal Structure of HLA-B*57:01-TW10-T242N complex
Resolution1.88 Å
Binding residue
(original residue number in PDB)
Y7 E63 N66 M67 S70 T73 N77 Y84 I95 Y99 Y123 T143 K146 W147 V152 Q155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 N66 M67 S70 T73 N77 Y84 I95 Y99 Y123 T143 K146 W147 V152 Q155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links