Structure of PDB 8f5a Chain A Binding Site BS01

Receptor Information
>8f5a Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAP
WIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYG
CDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>8f5a Chain E (length=10) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TSTLQEQIGW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f5a Crystal Structure of KS1 TCR in complex with HLA-B*57:01-TW10
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Y7 G62 E63 N66 M67 Y74 N77 Y84 I95 Y99 Y123 T143 K146 W147 V152 Q155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 G62 E63 N66 M67 Y74 N77 Y84 I95 Y99 Y123 T143 K146 W147 V152 Q155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links