Structure of PDB 8f17 Chain A Binding Site BS01

Receptor Information
>8f17 Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKM
QQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSL
AKEQRLNFGDDIPSALRIAKKKRWNSIEE
Ligand information
>8f17 Chain C (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PLDLCYWASLHCIVS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f17 Single-Shot Flow Synthesis of D-Proteins for Mirror-Image Phage Display
Resolution2.21 Å
Binding residue
(original residue number in PDB)		F37 N65 L68 L71 K72 K95 F98 F99 Q102 F131 D134 A138
Binding residue
(residue number reindexed from 1)		F14 N42 L45 L48 K49 K72 F75 F76 Q79 F108 D111 A115
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:8f17, PDBe:8f17, PDBj:8f17
PDBsum8f17
PubMed
UniProtQ9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)

[Back to BioLiP]